Protein Info for GFF372 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 179 to 209 (31 residues), see Phobius details amino acids 221 to 246 (26 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 295 to 320 (26 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details PF00375: SDF" amino acids 3 to 404 (402 residues), 231 bits, see alignment E=1.2e-72

Best Hits

KEGG orthology group: None (inferred from 42% identity to psu:Psesu_2558)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF372 hypothetical protein (Sphingobium sp. HT1-2)
MSLTVRIMIALVAGLACGIALSEFGGALDARIVDIAQPVGKAWLNGLQMPLIPLIFALLV
TGVASAASTARTSGTATRTLILFALLLTASAAVAALLGPLLLQFWPVPAGAVGALTGAGP
ASEVPGVRPSAEWLLGFIPANPIRSAAEGQVVAVVLFALVFGFAVTRVAEERRAALTGFL
AALVDTLLIVVGWVLWLAPIGVFALALVAGSRSGLATAGALLHYIAFIVLICLAVTALVY
PLVILLGRIAPGRFARAALPAQIIAFSTQSSIASLPAMIAASDGPLEIRESTRSIVLPLA
ISLFRITSPPANLGVALYVAAMNGVALGPVQIMLGVVVAAIVSLAAVGLPSQITFFTTTG
PICLAMGVPVEALPLLLAVETVPDIFRTVGNVTADMGVTHIIDRLGSGTGIRD