Protein Info for GFF3719 in Variovorax sp. SCN45

Annotation: Pyrimidine monooxygenase RutA (EC 1.14.99.46)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF00296: Bac_luciferase" amino acids 1 to 321 (321 residues), 166.1 bits, see alignment E=6.6e-53 TIGR03612: pyrimidine utilization protein A" amino acids 1 to 355 (355 residues), 713.6 bits, see alignment E=2.8e-219

Best Hits

Swiss-Prot: 94% identical to RUTA_VARPS: Pyrimidine monooxygenase RutA (rutA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K09018, putative monooxygenase RutA [EC: 1.14.-.-] (inferred from 94% identity to vap:Vapar_4838)

MetaCyc: 77% identical to pyrimidine monooxygenase RutA (Escherichia coli K-12 substr. MG1655)
RXN-12886 [EC: 1.14.99.46]; 1.14.99.46 [EC: 1.14.99.46]

Predicted SEED Role

"Predicted monooxygenase RutA in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.-.-

Use Curated BLAST to search for 1.14.-.- or 1.14.99.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>GFF3719 Pyrimidine monooxygenase RutA (EC 1.14.99.46) (Variovorax sp. SCN45)
MNVGIFIPIGNNGWLLSENAPQYKPSFELNKQITLKAERYGVDFALSMIKLRGFGGKTEF
WDHNLESFTLMAGLAAVTSKIKLFATAASLVMPPAIVARMSSTIDSISNGRFGLNLVTGW
QRPEYSQMGMWPGDQFFGTRYQYLSEYIQVLRDLWGTGQSDFKGEHFKMDDCRMSPQPQA
DMKVICAGQSDAGMEFSARYADYNFCFGKGVNTPKAFAPAAQKLIEATAKTGRHVTTYVL
MMVITDETDEAARAKWEHYKAGADHEAIAWLGQQGAADTKSGADTNVRQMADPTSAVNIN
MGTLVGSYESVARMLDEVAEVPGTEGVLLTFDDFVLGVEAFGERIQPLMKSRAHVQSPVP
SQVEPERLAA