Protein Info for GFF3719 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Predicted transcriptional regulator for fatty acid degradation FadQ, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 184 to 200 (17 residues), see Phobius details PF00440: TetR_N" amino acids 41 to 87 (47 residues), 51.9 bits, see alignment 5.1e-18 PF17939: TetR_C_30" amino acids 119 to 232 (114 residues), 66.1 bits, see alignment E=3.4e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF3719 Predicted transcriptional regulator for fatty acid degradation FadQ, TetR family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MERSSAGAGDDMVTKKAGPAVRRKRTEEAGKAERPNTQELILDAAEQRFAAQGYEGTSIR
QIAEAAEVNLGMFHYYWGSKQALCRAVLERRLGPIMAERVARLSSAVETRAPIEELLLAA
MEPSLMVTGASPEQRDAFRSFYGRMLADPSPDVREALGAIVDGFSREFMKELHRRCTHID
DKEFYWRMVFVFGAFFYAHNAHDRILTLLGAEFTAPPIEDAAQYLVRFVVGGLQAKPLSE
KTAPAPRRRGKPAER