Protein Info for GFF3718 in Xanthobacter sp. DMC5

Annotation: Epoxyqueuosine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR00276: epoxyqueuosine reductase" amino acids 5 to 317 (313 residues), 425.2 bits, see alignment E=8.1e-132 PF08331: QueG_DUF1730" amino acids 29 to 110 (82 residues), 76.7 bits, see alignment E=1e-25 PF13484: Fer4_16" amino acids 162 to 226 (65 residues), 82.2 bits, see alignment E=3.6e-27

Best Hits

Swiss-Prot: 63% identical to QUEG_ROSLO: Epoxyqueuosine reductase (queG) from Roseobacter litoralis (strain ATCC 49566 / DSM 6996 / JCM 21268 / NBRC 15278 / OCh 149)

KEGG orthology group: None (inferred from 85% identity to xau:Xaut_1809)

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>GFF3718 Epoxyqueuosine reductase (Xanthobacter sp. DMC5)
VPAGERLRAWVADGAYGDMGWMAETLDRRADPRTLWPDMRSVILLGLNYGPSEDPRAVLA
RKSAGAISVYARAEDYHDIIKPKLKRVARALLAEAGRRGVTADVKVFVDTAPLMEKPLAA
AAGLGWQGRHTNLVSREFGSWLFLGAIATTLELRPDAPEKDHCGSCRACLDACPTAAFPA
PYVIDARRCISYLTIEHKGPIPAELRPLMGNRIYGCDDCLAACPWNKFAQMGQEAKLAAR
AENDAPPLAELVALDDAAFRARFPKSPIKRVGRDRFVRNVLIAIGNSGDAALLPQVEARL
ADESALVRGAAVWALGRLADPSMVARLAAERGSAETDTGVSNEWIAVTSGA