Protein Info for GFF3716 in Xanthobacter sp. DMC5

Annotation: Undecaprenyl-diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 9 to 257 (249 residues), 227.4 bits, see alignment E=1.2e-71 PF02673: BacA" amino acids 9 to 258 (250 residues), 259.1 bits, see alignment E=2.7e-81

Best Hits

Swiss-Prot: 66% identical to UPPP_BRUSI: Undecaprenyl-diphosphatase (uppP) from Brucella suis (strain ATCC 23445 / NCTC 10510)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 90% identity to xau:Xaut_1807)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>GFF3716 Undecaprenyl-diphosphatase (Xanthobacter sp. DMC5)
MTLGDMLEALVLGLLEGLTEFIPVSSTAHILLAGHFLGFESNGHTFEVLIQLGAVLAILT
VYFQRFLRVAQQLPTNPGARRFVIGVLIAFLPAAVIGAAAHGFIKSVLFETPALICGTLI
FGGIILLFIDKVVPQPRYNNAMGLPWHVALIIGFFQCLAMIPGMSRSGSTIVGAMLMGVD
KRAAAEFSFFLALPTMFGAFAYDLFKNRNNLSMDDGLLIVIGFVAAFCAAVVVVKSLLDF
VSKHGYAPFGWWRIAVGIAGLIGLALVG