Protein Info for GFF3715 in Sphingobium sp. HT1-2

Annotation: Flagellar motor rotation protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 122 to 148 (27 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 86 to 193 (108 residues), 75.5 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 75% identity to sch:Sphch_2632)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>GFF3715 Flagellar motor rotation protein MotA (Sphingobium sp. HT1-2)
MIGILAHLFDPLTLAAMLGGVAVVALAQNGVQAVGRACVALRPLLRADPLRDRDAARTAL
LQIDQVAQLRGLMCIDRVKSDSGFMVDAARRLANCDRVEQFETWASQALADRAQRHASVR
NVWLSVADAAPALGMAGTIIGLVGMFAAMDDPSALGPSMALALLTTLYGVVIANLLAAPI
AARLATLSEQELAWQQEAVARMLAIARRENAPLRRASIREVA