Protein Info for GFF3714 in Variovorax sp. SCN45

Annotation: FMN reductase (NADH) RutF (EC 1.5.1.42)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03615: pyrimidine utilization flavin reductase protein F
  • amino acids 22 to 175 (154 residues), 269.3 bits, E=5.4e-85
• PF01613: Flavin_Reduct
  • amino acids 30 to 176 (147 residues), 136 bits, E=6e-44

Best Hits

Swiss-Prot: 88% identical to RUTF_VARPS: FMN reductase (NADH) RutF (rutF) from Variovorax paradoxus (strain S110)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 88% identity to vap:Vapar_4843)

MetaCyc: 65% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]

Predicted SEED Role

"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• bacterial bioluminescence (5/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Methane metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-

Use Curated BLAST to search for 1.5.1.- or 1.5.1.42

Protein Sequence (182 amino acids)

>GFF3714 FMN reductase (NADH) RutF (EC 1.5.1.42) (Variovorax sp. SCN45)
MLNAMASHASSPSPAGLPPGLQKADYRNAMARLGAAVNIITTDGPAGRAGFTASAVCSVT
DEPPTLLVCLNRSASVYPAFKANGVLCVNVLAAGHQSLSALFGGKTPMDERFAAGRWSSK
TTGSPMLDDAAVSFDCRVVHATSAGTHDVLFCEAVAIAIGGAAQGLIYFDRRYHEIAAPA
QH