Protein Info for GFF3710 in Sphingobium sp. HT1-2

Annotation: Flagellar basal-body rod protein FlgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR03506: flagellar hook-basal body protein" amino acids 5 to 121 (117 residues), 117.1 bits, see alignment E=7.3e-38 PF00460: Flg_bb_rod" amino acids 6 to 35 (30 residues), 25 bits, see alignment 2.2e-09 PF22692: LlgE_F_G_D1" amino acids 81 to 144 (64 residues), 51.2 bits, see alignment E=1.8e-17 PF06429: Flg_bbr_C" amino acids 198 to 238 (41 residues), 58.5 bits, see alignment 5.5e-20

Best Hits

Swiss-Prot: 42% identical to FLGF_ECOLI: Flagellar basal-body rod protein FlgF (flgF) from Escherichia coli (strain K12)

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 89% identity to sch:Sphch_2627)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF3710 Flagellar basal-body rod protein FlgF (Sphingobium sp. HT1-2)
MDRLVNTALTAMRGAMARQASIANNLANANTVGFRAEIANAETRWIKGDTFDTRAQASEQ
VIAADMAQGAVTETGNPLDVAMNGDALLAVQAPDGQEAYTRRGDLKVNDSGLLTTGDGLA
VLGQGGPITLPQMDSVSIAQDGSIWGVPQGGDPANPQQIDKLKLVNAAGSSIAKGTDGLF
REVNGGALPEDPIATVTSGSLEGSNVNATAALVQMIEASRAWETQIKMIDTAKQMDDGGA
SLMKLDG