Protein Info for GFF371 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF20582: UPF0758_N" amino acids 8 to 76 (69 residues), 75.5 bits, see alignment E=2.9e-25 TIGR00608: DNA repair protein RadC" amino acids 9 to 221 (213 residues), 304.7 bits, see alignment E=2e-95 PF04002: RadC" amino acids 102 to 220 (119 residues), 157.1 bits, see alignment E=1.8e-50

Best Hits

Swiss-Prot: 100% identical to YICR_SALG2: UPF0758 protein YicR (yicR) from Salmonella gallinarum (strain 287/91 / NCTC 13346)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to see:SNSL254_A4009)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>GFF371 DNA repair protein RadC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDTLDELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSA
DFAQFRGVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEERE
IFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPS
KADKLITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI