Protein Info for GFF3708 in Xanthobacter sp. DMC5

Annotation: PqqA peptide cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 23 to 378 (356 residues), 563.7 bits, see alignment E=1.5e-173 PF04055: Radical_SAM" amino acids 34 to 189 (156 residues), 92.9 bits, see alignment E=2.5e-30 PF13186: SPASM" amino acids 258 to 324 (67 residues), 35.2 bits, see alignment E=1.2e-12 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 261 to 351 (91 residues), 35.7 bits, see alignment E=9.3e-13

Best Hits

Swiss-Prot: 72% identical to PQQE_METS4: PqqA peptide cyclase (pqqE) from Methylobacterium sp. (strain 4-46)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 85% identity to xau:Xaut_1799)

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>GFF3708 PqqA peptide cyclase (Xanthobacter sp. DMC5)
MSEIATVARKEVSEGARPEAAPSVGHPIGILAELTHRCPLRCPYCSNPLELERREAELDT
ATWKRVLSEAAALGILHVHLSGGEPTARPDLVELTAHCAAEGLYTNLITSGIGRASGMID
ALSEAGLDHVQLSVQGASAETGDRIGGYKGGHAAKLEFARKVTDLGLPLTLNAVIHRGNI
HEVEDIIALAVALKARRLEVAHTQYYGWAYVNRAALMPARPDVDRSVALVEEARRRLEGI
LVIDMVIPDYYARYPKPCSGGWGRRTLNVTPTGRVLPCHAAESIPNLEFWSVRDRALGDI
WRSSPAFNAFRGTDWMREPCRSCDRREMDFGGCRCQAMALVGDAAATDPACSLSHFHARV
EALATEEAAAVAPDYLYRTIGGAPAKAPEGAAS