Protein Info for GFF3706 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 11, riboflavin/purine nucleoside/unknown)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 35 to 58 (24 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 17 to 281 (265 residues), 112.3 bits, see alignment E=1.2e-36

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 94% identity to vap:Vapar_4850)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF3706 ABC transporter, permease protein 2 (cluster 11, riboflavin/purine nucleoside/unknown) (Variovorax sp. SCN45)
MSGGIVLNWLASTPDFAVPYALAALGLIICERAGVLALGAEGLMLVGALAGIGAQIVIGQ
PAVSLVLAMLAASVVSVLFAVMVIWLRVNQVIAGLALVFFCQGLTALVGSMAEWTNHATE
GIGAMGLWPLSMLPGVGRLFEQNAMVWLTLPIFGAVAWFFARTSTGLRLRAVGENPQAAD
AAGIRVTAWRFAAVLAGSALVGLAGAYISVVSTKLWIAGMTGGRGWIAVGLVIFSRWSPW
KALVGALLFGCIEALIPQLAAAGVQLPQYFVMMTPYAVTLGVMVWVALSRRGADEEPGAL
GQPYVREERR