Protein Info for GFF3703 in Xanthobacter sp. DMC5

Annotation: Formyltransferase/hydrolase complex subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01913: FTR
  • amino acids 9 to 149 (141 residues), 189 bits, E=4e-60
• TIGR03119: formylmethanofuran--tetrahydromethanopterin N-formyltransferase
  • amino acids 14 to 303 (290 residues), 413.6 bits, E=2.4e-128
• PF02741: FTR_C
  • amino acids 152 to 303 (152 residues), 197.1 bits, E=1.7e-62

Best Hits

Swiss-Prot: 64% identical to FTR_METCA: Formylmethanofuran--tetrahydromethanopterin formyltransferase (ffsA) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K00672, formylmethanofuran--tetrahydromethanopterin N-formyltransferase [EC: 2.3.1.101] (inferred from 86% identity to xau:Xaut_1794)

MetaCyc: 53% identical to formyltransferase/hydrolase complex delta subunit (Methylorubrum extorquens AM1)
RXN-2884

Predicted SEED Role

"Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101)" in subsystem Methanogenesis (EC 2.3.1.101)

MetaCyc Pathways

• formaldehyde oxidation VI (H₄MPT pathway) (4/4 steps found)
• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• superpathway of C1 compounds oxidation to CO₂ (8/12 steps found)
• methanogenesis from H₂ and CO₂ (3/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (3/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (3/6 steps found)
• methoxylated aromatic compound degradation II (4/9 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (10/18 steps found)
• superpathway of methanogenesis (5/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.101

Protein Sequence (310 amino acids)

>GFF3703 Formyltransferase/hydrolase complex subunit D (Xanthobacter sp. DMC5)
VSAPAPFLINGVEIRDSFAEAFPMAGTRLIITADTPRWVHTAAASLTGFATSVIGCGCEA
AIEREIPADETPDGRPGYAVLIFAMSLKDLKKIVPLRAGQCVLTSPTSALYSGLEGGSAV
PLGKALRYFGDGHQMSKNLGGSRIWRIPVMEGEFVCDEIVGSTTAAVGGGNFLILARSRP
AALAAAEAAVAAMGQVRGAIMPFPGGVVRSGSKVGSKYAGLIASSNDAYCPTLRGIAKTA
LPAEVESVLEIVIDGLSEGEVADSMRAGITAVCGLGAAGGVVAVDAGNYGGNLGPFHFKL
HQLMAQEAGR