Protein Info for PS417_18950 in Pseudomonas simiae WCS417

Annotation: 3-dehydroquinate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01220: DHquinase_II
  • amino acids 5 to 140 (136 residues), 163.8 bits, E=9.6e-53

Best Hits

Swiss-Prot: 57% identical to AROQ_STRAW: 3-dehydroquinate dehydratase (aroQ) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 93% identity to pfs:PFLU4274)

MetaCyc: 51% identical to periplasmic dehydroquinate dehydratase (Gluconobacter oxydans)
3-dehydroquinate dehydratase. [EC: 4.2.1.10]

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• gallate biosynthesis (2/3 steps found)
• quinate degradation I (2/3 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• quinate degradation II (1/3 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (15/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.10

Use Curated BLAST to search for 4.2.1.10

Sequence Analysis Tools

See A0A1N7UNZ9 at UniProt or InterPro

Protein Sequence (148 amino acids)

>PS417_18950 3-dehydroquinate dehydratase (Pseudomonas simiae WCS417)
MTHPVFFLNGPNANLYGLDKAGTYGSESFASIQARCQDLAATLGLTLDFRQSNHEGVLVD
WIQEARLNADAIVINAAGLSYSSVPILDALLAFDGPIIETHMSNIWKRERFRHHSYVSKA
ATGVIAGLGALGYQLALTAVAELLDQTA