Protein Info for GFF3703 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR02378: nitrite reductase [NAD(P)H], small subunit" amino acids 3 to 107 (105 residues), 132.9 bits, see alignment E=2.2e-43 PF13806: Rieske_2" amino acids 3 to 106 (104 residues), 140.9 bits, see alignment E=6.7e-46

Best Hits

Swiss-Prot: 100% identical to NIRD_SALTI: Nitrite reductase (NADH) small subunit (nirD) from Salmonella typhi

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 94% identity to eoh:ECO103_4085)

MetaCyc: 94% identical to nitrite reductase (NADH) small subunit (Escherichia coli K-12 substr. MG1655)
RXN-13854 [EC: 1.7.1.15]

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.15 or 1.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF3703 Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSQWQNICKIDDILPGTGVCALSGGEQVAIFRPYHSDQVFAISNIDPFFEASVLSRGLIA
EHQGELWVASPLKKQRFRLSDGLCMEDEQFSVKHYDARVKDGVVQLRG