Protein Info for PS417_18935 in Pseudomonas simiae WCS417

Annotation: amino acid ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 115 (100 residues), 68.4 bits, see alignment E=3.1e-23 PF00528: BPD_transp_1" amino acids 36 to 220 (185 residues), 83.5 bits, see alignment E=2.4e-27 PF00005: ABC_tran" amino acids 274 to 429 (156 residues), 130.4 bits, see alignment E=1.1e-41 PF13304: AAA_21" amino acids 397 to 460 (64 residues), 28.5 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU4270)

Predicted SEED Role

"FIG00731493: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9G5 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PS417_18935 amino acid ABC transporter ATPase (Pseudomonas simiae WCS417)
MTFDWNYMFGLLGDAEFWRATWTVIKLSTLTWVLSIGLGFLLALAKQSRHGLLSVPARGY
IWLFRSLPLLVLLIFIYNLPQALPGTSAILADPFWSGLLALVICETAYVAEIHRGGLLSI
PKGQAEAARALGLKFFGTQWRVVIPQALRVALPSLANEYISIVKLTSLVSVISLTEILMV
GQRLYSQNFLVIETMAAVAFFYVFIVTVFDFLLKRLERFLDVNERNVSRVPDAAVLALAS
QQRTALARPATHGEPALQAARLHKAYNDIEVLGSVNLQIQPGEVVSVIGPSGSGKTTLIR
LLNGLEQLDNGEIRINGQPFIHLNKVGAQKPQYIEHAEHRLNIGMVFQSFNLFPHLTVLD
NLLMAPKYHRLGATAELKQQAYALLHKVGMLDHAWKYPHQLSGGQQQRVAIARALMMRPQ
IMLFDEPTSALDPEKVNEVLQVIEALAEEGITMVIVTHEMNFAFKVSDRIVFMEKGSVVC
DDTPGALRSGHNPRVEAFLKDVSLA