Protein Info for GFF3697 in Xanthobacter sp. DMC5

Annotation: Methenyltetrahydromethanopterin cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF02289: MCH" amino acids 24 to 334 (311 residues), 404.7 bits, see alignment E=1.4e-125 TIGR03120: methenyltetrahydromethanopterin cyclohydrolase" amino acids 25 to 335 (311 residues), 384.5 bits, see alignment E=1.8e-119

Best Hits

Swiss-Prot: 75% identical to MCH_XANAU: Methenyltetrahydromethanopterin cyclohydrolase (mch) from Xanthobacter autotrophicus

KEGG orthology group: K01499, methenyltetrahydromethanopterin cyclohydrolase [EC: 3.5.4.27] (inferred from 78% identity to xau:Xaut_1788)

MetaCyc: 58% identical to methenyltetrahydropterin cyclohydrolase subunit (Methylorubrum extorquens AM1)
Methenyltetrahydromethanopterin cyclohydrolase. [EC: 3.5.4.27]

Predicted SEED Role

"N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase (EC 3.5.4.27)" in subsystem Methanogenesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 3.5.4.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF3697 Methenyltetrahydromethanopterin cyclohydrolase (Xanthobacter sp. DMC5)
MTSAQTTTSAALAADPAPLPGGISLAHQVAPLVEALVADATQLRLAVSTGPLGCRIVDAG
ISVPGSLEAGRRIAEICLGGLGKVALVPGGRFSPFDTLVSVTTTDPVTACLASQYAGWSL
SHGDFFALGSGPGRAMAAVEPLFAELGCRDHGDHVALVLETGVTPPAEVVQEVASRCGVA
PTAVTFILTPTSSLAGTVQIVARVLEVALHKAHALHFPLEHIVDGIGSAPVAPPSPDFLT
AMGRTNDAVLYGGDVQLFVRGSSEAAQDLAKRLPSLASRDYGRPFAEIFAGYDCDFYKVD
PLLFSPARVTVTAMEQGTSFTAGGFDANLIARSFGV