Protein Info for GFF3697 in Xanthobacter sp. DMC5

Annotation: Methenyltetrahydromethanopterin cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02289: MCH
  • amino acids 24 to 334 (311 residues), 404.7 bits, E=1.4e-125
• TIGR03120: methenyltetrahydromethanopterin cyclohydrolase
  • amino acids 25 to 335 (311 residues), 384.5 bits, E=1.8e-119

Best Hits

Swiss-Prot: 75% identical to MCH_XANAU: Methenyltetrahydromethanopterin cyclohydrolase (mch) from Xanthobacter autotrophicus

KEGG orthology group: K01499, methenyltetrahydromethanopterin cyclohydrolase [EC: 3.5.4.27] (inferred from 78% identity to xau:Xaut_1788)

MetaCyc: 58% identical to methenyltetrahydropterin cyclohydrolase subunit (Methylorubrum extorquens AM1)
Methenyltetrahydromethanopterin cyclohydrolase. [EC: 3.5.4.27]

Predicted SEED Role

"N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase (EC 3.5.4.27)" in subsystem Methanogenesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 3.5.4.27)

MetaCyc Pathways

• formaldehyde oxidation VI (H₄MPT pathway) (4/4 steps found)
• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• superpathway of C1 compounds oxidation to CO₂ (8/12 steps found)
• methanogenesis from H₂ and CO₂ (3/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (3/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (3/6 steps found)
• methoxylated aromatic compound degradation II (4/9 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (10/18 steps found)
• superpathway of methanogenesis (5/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.27

Protein Sequence (336 amino acids)

>GFF3697 Methenyltetrahydromethanopterin cyclohydrolase (Xanthobacter sp. DMC5)
MTSAQTTTSAALAADPAPLPGGISLAHQVAPLVEALVADATQLRLAVSTGPLGCRIVDAG
ISVPGSLEAGRRIAEICLGGLGKVALVPGGRFSPFDTLVSVTTTDPVTACLASQYAGWSL
SHGDFFALGSGPGRAMAAVEPLFAELGCRDHGDHVALVLETGVTPPAEVVQEVASRCGVA
PTAVTFILTPTSSLAGTVQIVARVLEVALHKAHALHFPLEHIVDGIGSAPVAPPSPDFLT
AMGRTNDAVLYGGDVQLFVRGSSEAAQDLAKRLPSLASRDYGRPFAEIFAGYDCDFYKVD
PLLFSPARVTVTAMEQGTSFTAGGFDANLIARSFGV