Protein Info for GFF3697 in Sphingobium sp. HT1-2
Annotation: Argininosuccinate synthase (EC 6.3.4.5)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to ASSY_SPHWW: Argininosuccinate synthase (argG) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)
KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 96% identity to sjp:SJA_C1-31130)Predicted SEED Role
"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)
MetaCyc Pathways
- L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
- L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
- L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
- nitric oxide biosynthesis II (mammals) (2/3 steps found)
- superpathway of arginine and polyamine biosynthesis (12/17 steps found)
- urea cycle (3/5 steps found)
- superpathway of L-citrulline metabolism (8/12 steps found)
- canavanine biosynthesis (2/4 steps found)
- L-arginine biosynthesis IV (archaea) (4/9 steps found)
KEGG Metabolic Maps
- Alanine and aspartate metabolism
- Arginine and proline metabolism
- Urea cycle and metabolism of amino groups
Isozymes
No predicted isozymesUse Curated BLAST to search for 6.3.4.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (406 amino acids)
>GFF3697 Argininosuccinate synthase (EC 6.3.4.5) (Sphingobium sp. HT1-2) MSDKINRIVLAFSGGLDTSVILKWLQQTYQCEVVTFTADLGQGEELEPARAKARLMGVKE EHIFIDDLREEFVKDYVFPMMRGNALYEGLYLLGTSIARPLIAKRQIEIAKMLGADAVSH GATGKGNDQVRFELGYYALQPDIKVIAPWREWDLTSRTKLIEFAEQHQIPIPRDKRGESP FSTDANMLHTSSEGKVLEDPWEETPDFVYSRTVNPEDAPDAPEYITVDFERGDGVAINGI AMSPATLLETLNEYGRKHGIGRLDLVENRFVGMKSRGMYETPGGTIYHLAHRGIEQITLD RGAAHLKDELAPKYAELIYNGFWFSPEREMLQAAIDHSQEKVTGTVRLKLYKGGVYVVGR KSPYTLYSEKVVTFEDDAGAYDQRDAAGFIKLNALRLRLLGRRDGL