Protein Info for GFF3697 in Sphingobium sp. HT1-2

Annotation: Argininosuccinate synthase (EC 6.3.4.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF00764: Arginosuc_synth" amino acids 7 to 170 (164 residues), 215.5 bits, see alignment E=4.5e-68 TIGR00032: argininosuccinate synthase" amino acids 7 to 400 (394 residues), 475.6 bits, see alignment E=8e-147 PF20979: Arginosuc_syn_C" amino acids 181 to 398 (218 residues), 268.9 bits, see alignment E=3.3e-84

Best Hits

Swiss-Prot: 92% identical to ASSY_SPHWW: Argininosuccinate synthase (argG) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 96% identity to sjp:SJA_C1-31130)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>GFF3697 Argininosuccinate synthase (EC 6.3.4.5) (Sphingobium sp. HT1-2)
MSDKINRIVLAFSGGLDTSVILKWLQQTYQCEVVTFTADLGQGEELEPARAKARLMGVKE
EHIFIDDLREEFVKDYVFPMMRGNALYEGLYLLGTSIARPLIAKRQIEIAKMLGADAVSH
GATGKGNDQVRFELGYYALQPDIKVIAPWREWDLTSRTKLIEFAEQHQIPIPRDKRGESP
FSTDANMLHTSSEGKVLEDPWEETPDFVYSRTVNPEDAPDAPEYITVDFERGDGVAINGI
AMSPATLLETLNEYGRKHGIGRLDLVENRFVGMKSRGMYETPGGTIYHLAHRGIEQITLD
RGAAHLKDELAPKYAELIYNGFWFSPEREMLQAAIDHSQEKVTGTVRLKLYKGGVYVVGR
KSPYTLYSEKVVTFEDDAGAYDQRDAAGFIKLNALRLRLLGRRDGL