Protein Info for GFF3691 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 2, ribose/xylose/arabinose/galactose)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 297 to 314 (18 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 336 (276 residues), 133.5 bits, see alignment E=4.2e-43

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 96% identity to vpe:Varpa_5504)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF3691 ABC transporter, permease protein (cluster 2, ribose/xylose/arabinose/galactose) (Variovorax sp. SCN45)
MPPEQQTPPPRTPEAAQQQHRGEAKPRWTERLHGLGPVIGLVLLCIAGTLLNGDFATLDN
AMNVLTRTAFIGIIAVGMCFVIISGGIDLSVGSMAALIAGSVIMFINWAGPASGSPLLAV
VMGAVLAIVLGAVFGLAHGLLITKGRIEPFIVTLGTLGIFRAYLTYFADGGALTLDNDLS
DLYAPVYYASLAGIPVPVWVFVIVAIIGGVILNRTAYGRYVQAIGSNEQVARYAAVDVDR
VKILTYVLLGVCVGIATLLYVPRLGSASPTTGLLWELEAIAAVIVGGTALKGGAGSITGT
VVGAILLSVISNILNLTSIISVYLNAAVQGFVIIIVAFLQRGRR