Protein Info for GFF369 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 'Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00576: dUTP diphosphatase
  • amino acids 10 to 150 (141 residues), 167.6 bits, E=6.9e-54
• PF00692: dUTPase
  • amino acids 16 to 149 (134 residues), 149 bits, E=6.4e-48
• PF22769: DCD
  • amino acids 37 to 121 (85 residues), 44.6 bits, E=1.8e-15

Best Hits

Swiss-Prot: 100% identical to DUT_SALSV: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 93% identity to ecw:EcE24377A_4141)

MetaCyc: 92% identical to dUTP diphosphatase (Escherichia coli K-12 substr. MG1655)
dUTP diphosphatase. [EC: 3.6.1.23, 3.6.1.9]

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (3/3 steps found)
• dZTP biosynthesis (3/5 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Pyrimidine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23 or 3.6.1.9

Protein Sequence (151 amino acids)

>GFF369 'Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)' transl_table=11 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKIDVKILDPRVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIAD
PSLAAVMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDSFTIEPGERIAQMV
FVPVVQAEFNLVEAFDATERGEGGFGHSGRK