Protein Info for GFF3687 in Variovorax sp. SCN45

Annotation: ATP synthase beta chain (EC 3.6.3.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR01039: ATP synthase F1, beta subunit" amino acids 3 to 464 (462 residues), 818.9 bits, see alignment E=5.9e-251 PF02874: ATP-synt_ab_N" amino acids 6 to 71 (66 residues), 58.7 bits, see alignment E=1e-19 PF00006: ATP-synt_ab" amino acids 128 to 347 (220 residues), 229.9 bits, see alignment E=4.1e-72 PF22919: ATP-synt_VA_C" amino acids 351 to 441 (91 residues), 57.1 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 97% identical to ATPB_VEREI: ATP synthase subunit beta (atpD) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 98% identity to vap:Vapar_4869)

MetaCyc: 80% identical to ATP synthase F1 complex subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>GFF3687 ATP synthase beta chain (EC 3.6.3.14) (Variovorax sp. SCN45)
MAEGKIVQCIGAVVDVEFPRDQMPKVYDALKFEGSALTLEVQQQLGDGVVRTIALGSSDG
LRRGLIVTNTGAPITVPVGKATLGRIMDVLGSPIDERGPVGQELTASIHRKAPAYDELSP
SQDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGE
RTREGNDFYHEMADSGVVNLEKLEDSKVAMVYGQMNEPPGNRLRVALTGLTIAESFRDEG
RDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGRLQERITSTKVGSITSIQ
AVYVPADDLTDPSPATTFAHLDSTVVLSRDIASLGIYPAVDPLDSTSRQLDPNVVGEEHY
NVARAVQGTLQRYKELRDIIAILGMDELAPDDKLAVARARKIQRFLSQPFHVAEVFTGAP
GKYVPLAETIRGFKMIVNGEADHLPEQAFYMVGSIDEAFEKAKKVA