Protein Info for GFF3683 in Xanthobacter sp. DMC5

Annotation: Lactate utilization protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02754: CCG
  • amino acids 15 to 95 (81 residues), 52.9 bits, E=1.7e-18
  • amino acids 143 to 227 (85 residues), 53.1 bits, E=1.4e-18

Best Hits

Swiss-Prot: 50% identical to LUTA_EXISA: Lactate utilization protein A (lutA) from Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)

KEGG orthology group: None (inferred from 88% identity to xau:Xaut_1769)

MetaCyc: 45% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

• Bifidobacterium shunt (13/15 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• homolactic fermentation (10/12 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Protein Sequence (266 amino acids)

>GFF3683 Lactate utilization protein A (Xanthobacter sp. DMC5)
MTAHTSPHGARHPRVGLFCTCLVDTIRPSVGFAAAKLLEDAGCEVNVPPQTCCGQPAFNS
GDRATTRALAEEMITAFETFDYVVAPSGSCAGMIKTHYPELFTGEPDWAGRVERFCAKVF
ELTSFLVDVRGVTGVAAAYDGTVTYHDSCSGLRELGVKAQPRRLLASVEGLALEEMKDAD
TCCGFGGTFCVKYPDVSNAIVEKKSANIAATGADTLLAGDLGCLMNMAGKLQREGRAVRA
LHVAEVLAGMGDEPAIGEPAEKGAKR