Protein Info for GFF3680 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF13560: HTH_31" amino acids 11 to 65 (55 residues), 43.2 bits, see alignment 1e-14 PF12844: HTH_19" amino acids 14 to 66 (53 residues), 41.2 bits, see alignment 3.2e-14 PF01381: HTH_3" amino acids 15 to 69 (55 residues), 49 bits, see alignment 1.2e-16 PF06114: Peptidase_M78" amino acids 192 to 315 (124 residues), 73.6 bits, see alignment E=3.2e-24 PF09856: ScfRs" amino acids 317 to 466 (150 residues), 166 bits, see alignment E=1.6e-52

Best Hits

KEGG orthology group: K07110, (no description) (inferred from 82% identity to sch:Sphch_2567)

Predicted SEED Role

"Transcriptional regulator, XRE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF3680 hypothetical protein (Sphingobium sp. HT1-2)
MADVTDRKLYLGPKLRVLRRELGLNQTRMAEELGVSPSYLNHLERNQRPLTAQMLLRLAN
TYDIDIRDFTASSQDGAASDLAEILSDALVRDIGIARDEVLEVAENYPGVSEAIGRFYRA
LADLRRLPEQMQASGRGAAPAPLVAPVDWWRETVAKAGNHFAEIDAAAEGNAAELEEDPA
LLQAGLRARLKERHGMAVQMVRADVLAGTVRHYDMHRRRLMLSERLPASGRLFAMAYQLC
AQEMADLIAAQVTRTAPPDEDSRRLAIIALTNYAAAALIMPYDRFRQAAEASRHDLPLLR
ARFGVSTEQLAHRLTSLNRTGARGIPFFMVRIDRAGIVSKRFDGEAYPFARYGGTCPRWD
VHAADAPDIVLPQLIETLDERRFVTLAIALPRADGARGRQVIALGCEAKHAGRIIHADGI
DTERDDAVTVGPTCHLCERRDCPDRALPPVTRALDLHSYERTASPFPFRRV