Protein Info for GFF3679 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Triosephosphate isomerase (EC 5.3.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00121: TIM" amino acids 3 to 246 (244 residues), 312.8 bits, see alignment E=8.4e-98 TIGR00419: triose-phosphate isomerase" amino acids 4 to 237 (234 residues), 210.1 bits, see alignment E=2e-66

Best Hits

Swiss-Prot: 74% identical to TPIS_ACIAC: Triosephosphate isomerase (tpiA) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: None (inferred from 76% identity to xtr:100487764)

MetaCyc: 51% identical to triose-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF3679 Triosephosphate isomerase (EC 5.3.1.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRKLIAGNWKMNGSLAANEALVKAMLDGLAGQPPKADMALCVPAPYLAQVGALLQGSPIA
WGAQDVSSQEQGAYTGEVSAAMLRDFACRYAIVGHSERRQYHGETDALVAEKAKAALAKG
ITPIVCVGETLAEREAGHTEEVVKRQLAAVIHLCGHCITEIIVAYEPVWAIGTGKTATPE
EAQQVHAVLRAQISAATQNAGRVHILYGGSMNAANAASLLAQPDIDGGLIGGASLKAPDF
LQIVASAP