Protein Info for GFF3668 in Sphingobium sp. HT1-2

Annotation: dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 2 to 165 (164 residues), 50.3 bits, see alignment E=6.5e-17 PF08659: KR" amino acids 2 to 136 (135 residues), 25.6 bits, see alignment E=3.8e-09 PF01370: Epimerase" amino acids 3 to 236 (234 residues), 180.1 bits, see alignment E=1.7e-56 PF02719: Polysacc_synt_2" amino acids 3 to 231 (229 residues), 47.7 bits, see alignment E=4.3e-16 PF16363: GDP_Man_Dehyd" amino acids 4 to 319 (316 residues), 163.2 bits, see alignment E=4.1e-51 PF01073: 3Beta_HSD" amino acids 4 to 227 (224 residues), 43.6 bits, see alignment E=7.1e-15

Best Hits

KEGG orthology group: None (inferred from 89% identity to sjp:SJA_C1-31330)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF3668 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) (Sphingobium sp. HT1-2)
LTILVTGAAGFIGMAVADRLLADGRAVIGIDNLNDYYQVSLKRDRIAALEQRHGKLFTFA
ELDFADMPALQALLADHPIEAIVHLGAQAGVRYSLINPHAYVRSNLAGHVNMLELARERR
VRHLVYASSSSVYGGNESLPFRVEDRTDHPVSLYAATKRADELMSETYAHLFRVPMTGLR
FFTVYGPWGRPDMAMWIFTQKILAGEPIPVFNHGRMQRDFTYIDDIVAGVIGCLDSPPGD
DGALKAGGSRAPHRLYNIGNNRPEELMHLIAVLEEAVGRKAQLDFQPMQPGDVPATFADI
SAIAQDIGFAPTTGIELGVPRFVNWYRDYHRL