Protein Info for GFF3666 in Variovorax sp. SCN45

Annotation: Inner membrane protein YbiR, putative anion permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 100 to 127 (28 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 221 to 254 (34 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 331 to 354 (24 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details PF03600: CitMHS" amino acids 35 to 327 (293 residues), 110.6 bits, see alignment E=4.6e-36

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_5559)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF3666 Inner membrane protein YbiR, putative anion permease (Variovorax sp. SCN45)
MTTKDTVPTLASSPPAAPAADAPSTHEGGGNGLLWVLVAVAVLFAFIRPRAPMDWLKLVD
WQTVGALAGLLAITQGVERSGMLQSAAQRLLARTTDLRQLALLLTATAAVLSALVTNDVS
LFLLVPLTRVLATQAHLPLARLVVLQALAVNAGSALTPIGNPQNLYLWHRTGESFGGFML
MMAPTVLVMLFWLFVAVWLLVPRTAIALKPAAEAAPVQPRLLALSGVLFVGFVIALDRHW
LLVGLAVVFVAYLLFQRRVLLGVDWALLAIIALMFVDLRQLAELPAVASLVGQWPIAEGW
RAYLAAIVTSQFISNVPATILLDRYVHDLPALAAGVSVGGFGCVLGSLANLIALRLAKVP
HGLREFHRIGIPFLIVCAASAVLLRLG