Protein Info for GFF3663 in Sphingobium sp. HT1-2

Annotation: Beta-lactamase class A-like and penicillin binding proteins (PBPs) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF00144: Beta-lactamase" amino acids 59 to 145 (87 residues), 34.4 bits, see alignment E=2.1e-12 PF13354: Beta-lactamase2" amino acids 66 to 320 (255 residues), 155 bits, see alignment E=2.9e-49

Best Hits

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>GFF3663 Beta-lactamase class A-like and penicillin binding proteins (PBPs) superfamily (Sphingobium sp. HT1-2)
MMGDRRAMPSLRQIGASCAALGLFFAPLPSADAFGPPPRPQVLLTAEAHLLAEFDRFAAL
SDGTVGVAVQDLQTGEVQSRNGDTLFPMASAYKVAVAGRILSLVDAGSLRLDDRLALDPA
LASEGGIAWMFSRPGATLPVSQLLDLMLTRSDNNATDVLVARAGGPKAVSDFVAGLGIHG
LRVDSDTAHLLYRAMGINPQSGTFQQNAGAARRADPMIQRRDVRDLPNMDFMLDPRDTAT
PLAMNQLLVAYESGKALKPESTQLLFTIMGHCQTGKLRLSGMLPPGTPVAHKTGSLNGVG
NDVGIIGLPDGRRFAITVFVMKDSRGHVSRDQIMAQAARAAYDYFLFAPKRRVALNKLNV
HV