Protein Info for GFF3662 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00638589: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 TIGR00702: YcaO-type kinase domain" amino acids 11 to 404 (394 residues), 558.1 bits, see alignment E=4.8e-172 PF02624: YcaO" amino acids 59 to 391 (333 residues), 251.8 bits, see alignment E=1.1e-78 PF18381: YcaO_C" amino acids 407 to 581 (175 residues), 214.1 bits, see alignment E=1.3e-67

Best Hits

Swiss-Prot: 93% identical to YCAO_ECOLI: Ribosomal protein S12 methylthiotransferase accessory factor YcaO (ycaO) from Escherichia coli (strain K12)

KEGG orthology group: K09136, ribosomal protein S12 methylthiotransferase (inferred from 93% identity to eco:b0905)

MetaCyc: 93% identical to ribosomal protein S12 methylthiotransferase accessory factor YcaO (Escherichia coli K-12 substr. MG1655)
ATP diphosphatase. [EC: 3.6.1.8]

Predicted SEED Role

"FIG00638589: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.8

Use Curated BLAST to search for 3.6.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (586 amino acids)

>GFF3662 FIG00638589: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTQTFIPGKDAALEDSIARFQQKLLDLGFHIEEASWLNPVPNVWSVHIRDKECALCFTNG
KGATKKAALASALGEYFERLSTNYFFADFWLGETVANGPFVHYPNEKWFPLTENDDVPEG
LLDARLRAFYDPENELTGSQLIDLQSGNEARGVCGLPFTRQSDNQTVYIPMNIIGNLYVS
NGMSAGNTRNEARVQGLSEVFERYVKNRIIAESISLPEIPAEVMARYPAVMESIATLEAE
GFPIFAYDGSLGGKYPVICVVLFNPANGTCFASFGAHPDFGVALERTVTELLQGRGLKDL
DVFTPPTFDDEEVAEHTNLETHFIDSSGLISWDLFKQDADYPFTDWSFSGTTEEEFATLM
AIFAAEDKEVYIADYEHLGVYACRIIVPGMSDIYPAEDLWLANNNMGSHLRETLLSLPGS
AWNKEDYLNLIEQLDEEGFDDFTRVRELLGLATGADNGWYTLRVGELKAMLALAGGDLEQ
ALIWTEWTMEFNSSVFSPTRANYYRCLQTLLLLSQEDARQPLQYLNAFIKMYGAEAVEAA
SAALSGEAAFYGLPAVDHDLQAFPAHQSLLKAYDKLQRAKAAYWSK