Protein Info for PS417_18730 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 61 to 79 (19 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 239 to 266 (28 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details PF01032: FecCD" amino acids 10 to 328 (319 residues), 287.2 bits, see alignment E=1.4e-89 PF00950: ABC-3" amino acids 107 to 303 (197 residues), 29.7 bits, see alignment E=4.9e-11

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 98% identity to pfs:PFLU4220)

Predicted SEED Role

"Cobalt ABC transporter, permease component CbtK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9C9 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PS417_18730 ABC transporter permease (Pseudomonas simiae WCS417)
MTRTLLALALLLAALLAGVAIGETAISPQVVLQVLANKLWAASYVLDPIDEGVVWNYRLT
RALVAAACGAGLATCGVILQSLLRNPLADPYLLGISAGASTGAVLVALIGVGGGLISLSA
GAFVGAMAAFALVILLARASGSASGTGQIILAGIAGSQLFNALTAFLITKSASSEQARGI
LFWLLGNLSGVRWPSVWLAVPVAVAGLAVCLWHRRALDAFTFGSDSAASLGIPVRRVQFV
LVGCAALVTAVMVSIVGSIGFVGLVIPHAVRLLLGTGHSRLLPASALGGALFLIAADVLS
RTLIKGQVIPVGVVTALVGAPVFALILIGRRNAR