Protein Info for GFF3659 in Sphingobium sp. HT1-2

Annotation: putative phospholipase D family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF13091: PLDc_2" amino acids 35 to 172 (138 residues), 37.5 bits, see alignment E=2.1e-13 amino acids 231 to 341 (111 residues), 64.1 bits, see alignment E=1.2e-21 PF00614: PLDc" amino acids 298 to 320 (23 residues), 30.4 bits, see alignment (E = 2.9e-11)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 75% identity to sch:Sphch_2479)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>GFF3659 putative phospholipase D family protein (Sphingobium sp. HT1-2)
MASRQQEAPTSPISVTLNGNRLTVIEEGAALRNALVRLIDGARTSLKLYYYIFADDGSGR
LICERLVAARARGVAVTLMIDGFGSSDTPDSLFAPLIAAGGHFGRFGTRRSTRYLIRNHQ
KIALADDKRLMIGGFNVEDGYFGIPADDCWRDLGLLLEGPQAEAMARWYGQLWRWVTSKR
QRFRTLRAMVRHWHPSLHHDPADPFRWLIGGPTRRLSPWAQVVKHDMDRAQRLDMVEAYF
SPGRGMMKRIARAARRKGARLILPALSDNGATIAAARLLYGPLLRRGVEIYEYQPCKLHM
KLIVIDDAVYIGSANFDMRSLFLNLELMLRVEDAGFAEAMRGFITRQTGESRQISLETYR
ASRTGLTLIKQWISYLLVGVLDYTVTRRLNFRDPDAD