Protein Info for GFF3657 in Variovorax sp. SCN45

Annotation: Mlr5572 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 20 to 55 (36 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details PF14079: DUF4260" amino acids 13 to 124 (112 residues), 138.5 bits, see alignment E=4.7e-45

Best Hits

KEGG orthology group: None (inferred from 60% identity to sno:Snov_3089)

Predicted SEED Role

"Mlr5572 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>GFF3657 Mlr5572 protein (Variovorax sp. SCN45)
MAAAAAAGGGVRALLRLEGAAVLGVALAAYAQYGLGWGVFALWLLLPDVAMLGYLAGPRV
GAALYNATHSYVGPALLLALGVLAATPWAVAGGLIWFAHIGFDRALGYGLKYAAGFGNTH
LGRVGRADPW