Protein Info for GFF3656 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02493: pyruvate formate-lyase 1-activating enzyme
  • amino acids 1 to 208 (208 residues), 301.9 bits, E=1.4e-94
• PF04055: Radical_SAM
  • amino acids 1 to 147 (147 residues), 88.7 bits, E=5.1e-29
• PF13353: Fer4_12
  • amino acids 1 to 117 (117 residues), 37.1 bits, E=3.7e-13

Best Hits

Swiss-Prot: 97% identical to PFLA_ECOLI: Pyruvate formate-lyase 1-activating enzyme (pflA) from Escherichia coli (strain K12)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to sek:SSPA1701)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• mixed acid fermentation (16/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Protein Sequence (215 amino acids)

>GFF3656 Pyruvate formate-lyase activating enzyme (EC 1.97.1.4) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRCLYCHNRDTWDTHGGKEITVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDW
FRACKKEGIHTCLDTNGFVRRYDPVIDELLDVTDLVMLDLKQMNDEIHQNLVGVSNHRTL
EFAQYLSKKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWV
AMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMY