Protein Info for PS417_18700 in Pseudomonas simiae WCS417

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 220 to 233 (14 residues), see Phobius details PF00126: HTH_1" amino acids 4 to 61 (58 residues), 67.8 bits, see alignment E=6.4e-23 PF03466: LysR_substrate" amino acids 85 to 285 (201 residues), 140.1 bits, see alignment E=6.5e-45

Best Hits

Swiss-Prot: 62% identical to YNEJ_ECOLI: Uncharacterized HTH-type transcriptional regulator YneJ (yneJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU4211)

Predicted SEED Role

"LysR family transcriptional regulator YneJ" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZC3 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PS417_18700 LysR family transcriptional regulator (Pseudomonas simiae WCS417)
MDLVQLEIFKAVAEQGSISAAAQLIHRVPSNLTTRIKQLEQDLGVELFIREKSRLRLSPA
GWNFLGYARRILDLVQEARATVAGEEPQGAFALGSLESTAAVRIPALLAAYNQKHTKVEL
DLSTGPSGTMIEGVLSGRLTAAFVDGPLLHATLEGVAVFEEEMVVIAPLHHAPITRGQDV
NGESIYTFRSNCSYRHHLERWFSQDGAVPGKIFEIESYHGMLACVSAGAGLALMPRSMLD
SMPGSAAVSVWPLMDNFRILHTWLIWRRGTVSQSLNSFVKLLEEQGAIRAA