Protein Info for GFF3654 in Variovorax sp. SCN45

Annotation: DUF1275 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 32 to 60 (29 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 195 to 212 (18 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details PF06912: DUF1275" amino acids 24 to 232 (209 residues), 114 bits, see alignment E=4.2e-37

Best Hits

KEGG orthology group: None (inferred from 49% identity to rso:RSc0238)

Predicted SEED Role

"DUF1275 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF3654 DUF1275 domain-containing protein (Variovorax sp. SCN45)
MTSPSSTLVPHAADAAPVDPPGHGMLLAFTGGFVDTLGFVALFGLFTAHVTGNFVLIGAA
MAGDGHAGVVGKLLALPTFVIGVAATRLFQLRRERQGRDTAAPLVVIQLAGLVAFMLAGV
WAGPFAHGGGMQAIGVGLMGVLAMSVQNTAARSVFSRLTPSTVMTGNVTQLVMDLVDIAT
RAPGMAAAATRVHKAWPPVAAFAAGSLAGGLGYAHAGFWALLAPCIALVVLLRLLRKQ