Protein Info for GFF3653 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.99.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 34 to 57 (24 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details PF04976: DmsC" amino acids 1 to 267 (267 residues), 383.8 bits, see alignment E=2.4e-119

Best Hits

Swiss-Prot: 89% identical to DMSC_ECOLI: Anaerobic dimethyl sulfoxide reductase chain C (dmsC) from Escherichia coli (strain K12)

KEGG orthology group: K07308, anaerobic dimethyl sulfoxide reductase subunit C (DMSO reductase anchor subunit) (inferred from 99% identity to sea:SeAg_B0971)

MetaCyc: 89% identical to dimethyl sulfoxide reductase subunit C (Escherichia coli K-12 substr. MG1655)
DIMESULFREDUCT-RXN [EC: 1.8.5.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF3653 Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.99.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIFTVFGQCVAGGFIVLALALMKGDLRAETQQRVIACMFGLWVLMGIGFIASMLHLGSPM
RAFNSLNRVGASALSNEIASGSVFFAVGGIGWLLAVLKKLPPALRTLWLIITMVLGVVFV
WMMVRVYNSIDTVPTWYSVWTPLGFFLTLFMGGPLLGYLLLRIAGVNGWAMRLLPAVSVL
ALVVIAIMVAMQGAELATIHSSIQQASALVPDYGSLMAWRMVLLAAALCCWIVPQLKGYQ
PAVPLLSVAFILMLAGELIGRGVFYGLHMTVGMAVAS