Protein Info for GFF3649 in Variovorax sp. SCN45

Annotation: C-type cytochrome biogenesis protein ResA (thioredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF08534: Redoxin" amino acids 28 to 153 (126 residues), 93.3 bits, see alignment E=2e-30 PF00578: AhpC-TSA" amino acids 29 to 143 (115 residues), 69.6 bits, see alignment E=3.7e-23 PF13098: Thioredoxin_2" amino acids 42 to 161 (120 residues), 36.1 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_5578)

MetaCyc: 54% identical to protein disulfide reductase CcsX (Bordetella pertussis)
RXN-21403 [EC: 1.8.4.16]

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>GFF3649 C-type cytochrome biogenesis protein ResA (thioredoxin) (Variovorax sp. SCN45)
MKKYIAAAAVVIALATGVGVYLGSGATAAPASTFVLLDGTQKSTADLKGKVTLVNFWATS
CVTCVGEMPKVIATYDKYKAQGYDTLAVAMSYDPPSYVVNFAETRKLPFKVAIDNTGSVA
QAWGDVKLTPTTYLVNKRGEIVKRYVGEPDFAELHKLIEKLLAEA