Protein Info for GFF3646 in Variovorax sp. SCN45

Annotation: Histone acetyltransferase HPA2 and related acetyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00583: Acetyltransf_1" amino acids 94 to 174 (81 residues), 56 bits, see alignment E=9.8e-19 PF13508: Acetyltransf_7" amino acids 99 to 175 (77 residues), 50.2 bits, see alignment E=5.4e-17 PF13673: Acetyltransf_10" amino acids 117 to 177 (61 residues), 30.1 bits, see alignment E=8.6e-11 PF08445: FR47" amino acids 118 to 177 (60 residues), 31.2 bits, see alignment E=3.6e-11

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_5581)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>GFF3646 Histone acetyltransferase HPA2 and related acetyltransferases (Variovorax sp. SCN45)
MSFSVSRPLPLSAMPAVVLLSPDEAHEIDAVRAIFRDYANSLGIDLDFQDFEGELAGLPG
EYAEPRGTLLLALVDPVNVKEEAGRQAPTLKRADGTLAHVAGCCALRPLDSADYANAAEM
KRLYVRPGFRGLGLGRQLAEAILDAARSAGYGCVLLDTLDDMESARALYEDLGFAEVPPY
YHNPVAGAHYLKVDL