Protein Info for GFF3646 in Sphingobium sp. HT1-2

Annotation: symbiosis island integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF13356: Arm-DNA-bind_3" amino acids 4 to 88 (85 residues), 62.6 bits, see alignment E=4.7e-21 PF22022: Phage_int_M" amino acids 95 to 187 (93 residues), 88.2 bits, see alignment E=5.4e-29 PF00589: Phage_integrase" amino acids 213 to 363 (151 residues), 65.3 bits, see alignment E=9.2e-22

Best Hits

KEGG orthology group: None (inferred from 74% identity to sjp:SJA_C1-31510)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF3646 symbiosis island integrase (Sphingobium sp. HT1-2)
MGKLTANEVKAALSKPGTYSDGDGLFLKVSKTGGASWLLRVQHEGERRDIGLGSAKLVTL
AGVRAKAAEARRAIREDGRDLVAEKRKAKAESVLFREAALTYFETHKSQWSNTKSEDQWI
NSMEAYAFPSLGSKPVGSITAGEIITAISKIWTEKPETGRRVKQRIRAVLNFAHARGWRS
TEAPADALAAGNGLPKQRSGKHHAAMPYADLPAFITRLRTAGGTWSRLALEFVILTAARS
QEVRLATWSEIDLEKGLWTVPADHMKMRIEHVVPLSPHALTVLHSAMAIRRQGTDLIFPG
ANGGAMSDMTLLAVLRRMKEPTTVHGFRSSFRTWVAEETNVPGEVAEAALAHQNRNEVER
AYQRGGLLDKRRKLMEAWGAYCSNDTALANVVPFKQAG