Protein Info for GFF3643 in Variovorax sp. SCN45

Annotation: LSU ribosomal protein L29p (L35e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 83 PF00831: Ribosomal_L29" amino acids 20 to 75 (56 residues), 69.6 bits, see alignment E=9.2e-24 TIGR00012: ribosomal protein uL29" amino acids 21 to 75 (55 residues), 58.6 bits, see alignment E=2.4e-20

Best Hits

Swiss-Prot: 76% identical to RL29_RHOFT: 50S ribosomal protein L29 (rpmC) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K02904, large subunit ribosomal protein L29 (inferred from 100% identity to vap:Vapar_4905)

Predicted SEED Role

"LSU ribosomal protein L29p (L35e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (83 amino acids)

>GFF3643 LSU ribosomal protein L29p (L35e) (Variovorax sp. SCN45)
MATRKKKETAAPAKVTKAATLRTKDVAGLQAEIKDLQKAHFGLRMQKATQQLSNTSTLRV
TRRDIARAKTILAQKQQETQAAK