Protein Info for GFF3643 in Sphingobium sp. HT1-2

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 transmembrane" amino acids 111 to 128 (18 residues), see Phobius details PF01609: DDE_Tnp_1" amino acids 3 to 127 (125 residues), 65.6 bits, see alignment E=8.2e-22 PF13612: DDE_Tnp_1_3" amino acids 4 to 105 (102 residues), 36.5 bits, see alignment E=7.1e-13 PF13586: DDE_Tnp_1_2" amino acids 45 to 126 (82 residues), 59.2 bits, see alignment E=7e-20

Best Hits

KEGG orthology group: None (inferred from 92% identity to oan:Oant_4638)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>GFF3643 Mobile element protein (Sphingobium sp. HT1-2)
MNTKLHAVTDTNGRPISFFMTAGQVSDYIGAAALLDELPKAQWLLADRGYDADWFRDALQ
EKGITPCIPGRKSRNKAVKYDKRRYKRRNRIEIMFGRLKDWRRVATRYDRCPNAFFSAIA
LAATVIFWL