Protein Info for GFF3640 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Di/tripeptide permease DtpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details amino acids 457 to 478 (22 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 17 to 485 (469 residues), 459.1 bits, see alignment E=1e-141 PF07690: MFS_1" amino acids 35 to 369 (335 residues), 61 bits, see alignment E=9.6e-21 PF00854: PTR2" amino acids 89 to 446 (358 residues), 324 bits, see alignment E=1.3e-100

Best Hits

Swiss-Prot: 100% identical to DTPA_SALTY: Dipeptide and tripeptide permease A (dtpA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 99% identity to sek:SSPA1301)

MetaCyc: 91% identical to dipeptide/tripeptide:H+ symporter DtpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-267; TRANS-RXN0-288

Predicted SEED Role

"Di/tripeptide permease DtpA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>GFF3640 Di/tripeptide permease DtpA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VSTANKKPTESVSLNAFKQPKAFYLIFSIELWERFGYYGLQGIMAVYLVKQLGMSEADSI
TLFSSFSALVYGLVAIGGWLGDKILGTKRVIMLGAVVLAIGYALVAWSGHDAGIVYMGMA
AIAVGNGLFKANPSSLLSTCYAKDDPRLDGAFTMYYMSVNIGSFFSMLATPWLAARYGWS
TAFALSVVGMLITVVNFAFCQRWVKSYGSKPDFEPINFRNLLLTIVGIVVLIAVATWLLH
NQDIARMVLGVIALGIVIIFGKEAFSMHGAARRKMIVAFILMLQAIIFFVLYSQMPTSLN
FFAIRNVEHSILGIAFEPEQYQALNPFWIIIGSPILAAIYNRMGDTLPMPMKFAIGMVLC
SGAFLILPLGAKFANDAGIVSVNWLIASYGLQSIGELMISGLGLAMVAQLVPQRLMGFIM
GSWFLTTAGANIIGGYVANLMAVPSDVTDPLMSLEVYGRVFMQIGIATAVIAVLMLLTAP
KLNRMTQDDDTAEKGSKAATV