Protein Info for GFF3639 in Xanthobacter sp. DMC5

Annotation: IS1182 family transposase ISGdi16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF05598: DUF772" amino acids 17 to 112 (96 residues), 116 bits, see alignment E=1.4e-37 PF01609: DDE_Tnp_1" amino acids 142 to 442 (301 residues), 56.2 bits, see alignment E=6.3e-19 PF13751: DDE_Tnp_1_6" amino acids 320 to 446 (127 residues), 53.1 bits, see alignment E=5.9e-18

Best Hits

KEGG orthology group: None (inferred from 92% identity to xau:Xaut_0557)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>GFF3639 IS1182 family transposase ISGdi16 (Xanthobacter sp. DMC5)
MMGERTGAQEALFYEFSLERHVPAGHLVRAIDRFVDLSGVRAHLKPFYSETGRPSIDPEL
MIRMLLIGYCFGIRSERRLCEEVHLNLAYRWFCRFGLDGRVPDHSTFSKNRHGRFRDSDL
LRHLFETVLQRCIAEGLVGGEGFAVDASLIKAEASRQKGVEGKVGLSPQAAGRAVEEYLA
VLDDAAFGAATEVTPKFISPADPAARWTGAHGGQAFFAYSTNYLIDVENAIIVDVEATTA
IRQAEVLAAKRMIERSMERFDLYPARLMGDSAYGSAEMLAWLVHEQGIEPHIPVFDKSAR
RDGTFSRADFAYDHDHDLYTCPGGKELRQYRRRFGVTRDGVDPQGLMRYRASKFDCDVCV
LKPSCCPGAPSRKVLRSIHEGARDMARDIAATEAYVTSRRQRKKVEMLFAHLKRILRLDR
LRLRGPNGARDEFHLAATAQNLRKLAKLMPSGARTATT