Protein Info for GFF3636 in Variovorax sp. SCN45

Annotation: LSU ribosomal protein L4p (L1e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF00573: Ribosomal_L4" amino acids 19 to 203 (185 residues), 218 bits, see alignment E=4.5e-69 TIGR03953: 50S ribosomal protein uL4" amino acids 19 to 203 (185 residues), 222 bits, see alignment E=2.1e-70

Best Hits

Swiss-Prot: 98% identical to RL4_VARPS: 50S ribosomal protein L4 (rplD) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02926, large subunit ribosomal protein L4 (inferred from 98% identity to vpe:Varpa_5591)

MetaCyc: 53% identical to 50S ribosomal subunit protein L4 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L4p (L1e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF3636 LSU ribosomal protein L4p (L1e) (Variovorax sp. SCN45)
MQLELLNEQGQAASKYDAPETVFGRDYNEDLVHQIVVAFQANARQGTRAQKDREQVKHST
KKPFKQKGTGRARAGMTSSPLWRGGGRIFPNMPDENFSQKINKKMYRAGMASIFSQLARE
GRLAVVDSIKVDSPKTKPLAARFKAMNLESVLVIAEEVDENLYLASRNLVNVLVVEPRYA
DPVSLVHYKKVLVTKGAVDKLKEMFA