Protein Info for GFF3632 in Sphingobium sp. HT1-2

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 119 to 135 (17 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 262 (170 residues), 106.4 bits, see alignment E=7.9e-35

Best Hits

Swiss-Prot: 45% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 88% identity to sch:Sphch_3543)

MetaCyc: 45% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>GFF3632 Alkanesulfonates transport system permease protein (Sphingobium sp. HT1-2)
MTALAIRGDTPLQRARRRFSLARFGGRWLSPLLLLLLWELGSRTGLIPERTLAAPSAVIG
TLIQMVLSGELPSNLLVSFGRVAVGLLIGVGLGLALGLAAGLSRGAELAIDPLMQIKRTI
PALALTPLFIVWFGIGETPKIALIAFGTIFPVYLNLYAGIRGVDPRLLDAAKSFGLSRWE
QVWHVVLPAALPSLLVGLRYALSISILVLVVAEQINASAGLGYLINNARDFMRTDIIVVC
LMVYAILGLGADWLVRSLEARALVWRPSIVEN