Protein Info for PS417_01850 in Pseudomonas simiae WCS417
Updated annotation (from data): phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR03188.
Original annotation: phosphoribosyl-ATP pyrophosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to HIS2_PSEFS: Phosphoribosyl-ATP pyrophosphatase (hisE) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 100% identity to pfs:PFLU0385)Predicted SEED Role
"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- L-histidine biosynthesis (10/10 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Histidine metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.6.1.31
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U131 at UniProt or InterPro
Protein Sequence (110 amino acids)
>PS417_01850 phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (Pseudomonas simiae WCS417) MSDTLNRVAQVLEDRKGADADSSYVASLYHKGLNKILEKLGEESVETIIAAKDAQISGDC SDVIYETADLWFHSLVMLAQLGQHPQAVLDELDRRFGLSGHAEKASRPSA