Protein Info for GFF3629 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG01045166: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 72 to 88 (17 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details amino acids 438 to 455 (18 residues), see Phobius details amino acids 462 to 482 (21 residues), see Phobius details amino acids 496 to 514 (19 residues), see Phobius details amino acids 569 to 586 (18 residues), see Phobius details PF04632: FUSC" amino acids 20 to 663 (644 residues), 458.4 bits, see alignment E=5.1e-141 PF13515: FUSC_2" amino acids 33 to 163 (131 residues), 57.9 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 100% identical to YDHK_SALTY: Uncharacterized transporter YdhK (ydhK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 91% identity to cko:CKO_01657)

Predicted SEED Role

"FIG01045166: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (679 amino acids)

>GFF3629 FIG01045166: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLSLPALRNTPWFKATSGQWRYALRNTIAMCLALTFAYYLNLDEPYWAMTSAAVVSFPT
VGGVISKSLGRIAGSLLGATAALIIAGHTLNEPWLFLFSMAAWIGFCTWACAHFTNNAAY
AFQLSGYTAAIIAFPMVNIVEITQLWDIAQARVCEVIVGILCGGMMMMILPSTSDGTALL
TAFKNMHARLLEHASLLWQPETTDAIRSAHEGVIGQILTMNLLRIQAFWSHYRFRRQNAL
LNALLHQQLRLTSVISSLRRMLLNWPTPPENSREVIEQLLAELAKPRADSYTVAQIIAPL
RPQDEQDYRHLAFWQRLRYFCQLYLRSSRQLYLIESGAPVDQIHIRRTPGLARHTDNAEA
IWSGVRTFCTLTVIGAWSIGAQWESGPGALTLAAISCVLYSIVATPFKSLSLLMRTLVLL
SLFSFVVKFGLMVQITDLWQFLLFLFPLFVTMQLLKLQMPKLAGLWGQLIVFMGSFIAVT
NPPVYDFADFLNDNTAKIVGVAISWLAFAILRPGSDAVKSRRHIRALRRDFVDQLSRHPS
HNESEFESLTYHHVSQLSNSQDALARRWLLRWGVVLLNCSHVVWQLRAWESRSDPLSRVR
DICISLLRDVMSERGVQQRPLAVTLQELQRICDTLAHHHQPAAHELAAIIWRLHCSLSQL
EQAPAQGTLAPGYLMTPQA