Protein Info for GFF3626 in Sphingobium sp. HT1-2

Annotation: Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00596: Aldolase_II" amino acids 25 to 204 (180 residues), 151.5 bits, see alignment E=1.2e-48

Best Hits

Swiss-Prot: 67% identical to Y1201_CAUVC: Putative aldolase class 2 protein CC_1201 (CC_1201) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 88% identity to sch:Sphch_3549)

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF3626 Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (Sphingobium sp. HT1-2)
MATILKDDRFSRTGISEAEWKVRVDLAAFYRLSALYGWDDFIYTHISARVPGPDHHFLIN
PFGLMFDEITASSLVKVDLDGNVIGESDYGINYAGYVIHSAIHGARDDAHYIAHFHSADG
MAVSAHAEGLLPLNQRALALIPRLSYHDYEGVALNLDERERLVADLGDTKVMLLRNHGTL
ALGASPGEAWSGIYQLESACTAQVRSLSVGRDNVLIAPEEAQAEVKRQMSRERQPVEGRR
THYDLVWEAALRKASRQAAGYDA