Protein Info for GFF3624 in Sphingobium sp. HT1-2

Annotation: Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 10 to 425 (416 residues), 548.2 bits, see alignment E=6.2e-169 PF00296: Bac_luciferase" amino acids 28 to 382 (355 residues), 165.2 bits, see alignment E=1.2e-52

Best Hits

Swiss-Prot: 54% identical to MOXC_BACSU: Putative monooxygenase MoxC (moxC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 85% identity to sjp:SJA_C2-01500)

MetaCyc: 54% identical to N-acetyl-S-alkylcysteine sulfoxide C-monooxygenase (Bacillus subtilis subtilis 168)
1.14.14.-

Predicted SEED Role

"Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>GFF3624 Nitrilotriacetate monooxygenase component A (EC 1.14.13.-) (Sphingobium sp. HT1-2)
MARSPHIKLGFILHGVGRTWHDWRHPDRDVNASTSLARYQEQAATAERGKFDFLFVADSL
SITERSSPHYLNRFEPITILSALAATTSQIGLVGTLTVSYSEPFNVARQFASLDHLSGGR
AGWNVVTSWLGDTAANFSKSEHPAHAVRYRIAAEYLDVVQGLWDSWEDGAHVADKESGQF
VDPDRLHALDHKGEFFQVRGPLNIKRTPQGQPVIFQAGASDDGRNFAARRAEVIFTHAET
IEAGQAYYADVKARAKGFGRDADQLFILPGIAAIVGDSDEEAEARYRELAALESIDTGLG
FLSRTFNDHDFRQYDLDAPFPDVAHLGLNSQQSGTLRILAEVEAEGLTLRQVAERLATPR
GAFVGSAETVADQLQRWFENGAADGFVLFEPLPGQLALFVDKVIPILQQRGLFRTNYEGT
TFREHLGLSVPDNRYSVAREAKSAA