Protein Info for GFF3623 in Xanthobacter sp. DMC5

Annotation: Fe(3+) dicitrate transport system permease protein FecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 59 to 77 (19 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 185 (17 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 233 to 263 (31 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details PF01032: FecCD" amino acids 16 to 325 (310 residues), 252.1 bits, see alignment E=3.4e-79

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 66% identity to mrd:Mrad2831_6079)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF3623 Fe(3+) dicitrate transport system permease protein FecD (Xanthobacter sp. DMC5)
VMPKRLILPLALACLALGLFCASVAVGYAPLDIGAAFDDLLAGRPSLSALALAELRLPRA
ILGAAVGFSLGITGAALQGLMRNPLADPGVVGVSGAAALGAVIAFYFGFSSTFALALPIG
GLAGAADATAVLLTLAARGAGTVVLILAGVALSSLAGALTALALNLAPSPYAALELVFWL
IGLLSDRGMVHVALALPFMAIGWALVLGTGSALDALTLGEDASESLGFTLRRIRLLVIAG
TAAAVGASVAVAGAIGFVGLVVPRLMRPLVGHRPGRLLLASGLAGAALTLGADIVVRLIP
TRPELKLGVVTALIGAPFFLFLLIRLKGMER