Protein Info for GFF3622 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00268: Ribonuc_red_sm
  • amino acids 1 to 265 (265 residues), 270.1 bits, E=1.2e-84

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Protein Sequence (427 amino acids)

>GFF3622 hypothetical protein (Xanthobacter sp. DMC5)
MPTEVSMQADIALWKSRGGLTEDERRMLKRNLGFFAASESLVANNIMLTIYRHLTNPECR
QYLLRQAFEEAIHTHTFQYIVENLALDEGELFNMYREVPSITDKAAWALKHTQSLDDPEF
RTGTPEAGQKFLRDFVAFYVVLEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIH
LNFGIDVINQIKIENPHLWTQAFQDEVRGMLKDAAELEAAYGRDTMPRGLLGLKAALGEQ
YMHFIANRRCAQLGLAPVFAEAENPFPWKSEAMDLKKEKNFFETRVIEYQNGGALAWPGT
ERGDCRRHDGGWRRASLMDRFPPSSVVSLAEELRSTSTSCRGDSPGYPDIACVSLKRTKI
SRVSPPFPLPTSERPRRFCRTSPWPSSVSCGDLRGADRVRNSVHAFNQRDGAGTLAMIRT
VGALGDA