Protein Info for GFF3622 in Variovorax sp. SCN45

Annotation: Porphobilinogen synthase (EC 4.2.1.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 67% identical to HEM2_PSEAE: Delta-aminolevulinic acid dehydratase (hemB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01698, porphobilinogen synthase [EC: 4.2.1.24] (inferred from 94% identity to vap:Vapar_4926)

MetaCyc: 59% identical to porphobilinogen synthase subunit (Rhodobacter capsulatus)
Porphobilinogen synthase. [EC: 4.2.1.24]

Predicted SEED Role

"Porphobilinogen synthase (EC 4.2.1.24)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.24)

MetaCyc Pathways

superpathway of heme b biosynthesis from glutamate (9/10 steps found)
tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
superpathway of heme b biosynthesis from glycine (6/8 steps found)
tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
adenosylcobalamin biosynthesis II (aerobic) (23/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (22/36 steps found)
superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF3622 Porphobilinogen synthase (EC 4.2.1.24) (Variovorax sp. SCN45)
MFPAGRPRRLRRDAFTRNLVREHALTVNDLIYPVFVQEGEKQREAVPSMPGVDRLSLDLL
LPVAEQCVEAGIPVMALFPVIDASLKTPDGREAFNPDGLIPRVVAALKARFPELGVMTDV
ALDPYTSHGQDGLLDDTGYILNEETVEILVKQALTQSQAGVDIVAPSDMMDGRIGAVRQA
LEARGDIHTRIMAYSAKYASAFYGPFRDAVGSAATLGKSNKKVYQMDPGNSDEALREVAL
DIAEGADMVMVKPGMPYLDIVRCVKDEFRVPTFAYQVSGEYAMLKAAAQNGWLDHDAVVL
ESLLAFKRAGADGVLTYFALDAARLLKK